A practical reference on ghrelin receptor: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-02-05. Anything still debated is marked as such rather than presented as settled.
Published animal and early human work describes growth hormone release that is separated from comparable rises in adrenocorticotropic hormone and cortisol. Prolactin changes are reported as small in the same studies. Selectivity is attributed to binding at the ghrelin receptor and to the downstream signaling that follows, rather than to differences in how quickly the peptide is cleared. Authors commonly label the compound selective rather than potent, because the same mass produces a smaller growth hormone response than some older secretagogues tested in parallel. Whether that profile holds across species and routes of administration remains an open question.
Human data remain limited and come mainly from small, short-term studies conducted decades ago. The peptide has not received approval as a medicine from major regulators, so current availability is largely as a research chemical. Reported effects on growth hormone pulsatility, appetite, and body composition should be read as preliminary, since few independent groups have replicated the original findings. Analytical characterization of research-grade material varies between suppliers, which complicates comparison across studies. Regulatory status also differs by country, and some jurisdictions classify it as a prescription-only or otherwise restricted item.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class. It acts as an agonist at the ghrelin receptor, also called the growth hormone secretagogue receptor type 1a. The compound was designed in the 1990s during a search for agents that release growth hormone with fewer off-target hormonal effects than earlier secretagogues. It appears in the research literature under several sequence-based names. Material supplied for laboratory work is normally a lyophilized solid, and it is not marketed as an approved therapeutic in major jurisdictions.
Compared with other secretagogues such as GHRP-2, GHRP-6, and hexarelin, ipamorelin is described as more selective. Published animal work reports little or no increase in adrenocorticotropic hormone, cortisol, or prolactin at doses that release growth hormone. This selectivity is the property most often cited in the research literature. Whether the same profile holds across species and dosing schedules remains an open question, since human data are limited and come largely from small studies.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue family. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, and its molecular mass is approximately 711.9 daltons. The compound was described in the late 1990s by researchers seeking molecules that release growth hormone with fewer side effects than earlier secretagogues. It is a laboratory and research compound, not an approved medicine in most jurisdictions.
At the molecular level, ipamorelin acts as an agonist at the growth hormone secretagogue receptor, also called the ghrelin receptor or GHS-R1a. Binding to this receptor on pituitary somatotroph cells triggers a signaling cascade that leads to growth hormone release. The effect is mediated through phospholipase C and calcium mobilization rather than through the cyclic AMP pathway used by growth hormone releasing hormone. The two pathways are complementary, and combined stimulation produces a larger response than either alone.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H49N9O5 | Value for the free base |
| Molar mass | 711.9 g/mol | Calculated from the formula |
| Appearance | White to off-white powder | Typical lyophilized form |
| Mechanism class | Ghrelin receptor agonist | Also described as a secretagogue |
| Half-life | About 2 hours | Reported for human circulation |
Identity and purity are assessed by complementary methods rather than a single test. Reversed-phase high-performance liquid chromatography separates the peptide from related impurities and reports a percentage purity. Mass spectrometry, most often with electrospray ionization, confirms the expected molecular mass and detects sequence-related variants. Amino acid analysis can verify composition, while water content and residual counterion measurements support the mass balance of a batch. Stability studies under accelerated conditions are used to estimate shelf life, though such estimates carry uncertainty for long-term storage.
Material supplied for research use is normally a white to off-white lyophilized powder. The solid is hygroscopic and is handled in a low-humidity environment to limit water uptake. Bulk quantities are frequently shipped in sealed vials under inert gas. Once reconstituted in water or a neutral buffer, the solution is less stable than the dry powder and is usually divided into single-use aliquots.
One distinguishing feature reported in animal studies is selectivity. Ipamorelin stimulated growth hormone release with limited elevation of adrenocorticotropic hormone or cortisol compared with earlier secretagogues such as GHRP-6. This pattern has been described as more selective for the growth hormone axis. The finding comes mainly from preclinical work, and the degree to which it holds across species and doses is not fully settled. Reports also describe effects on gastric motility in animal models, suggesting activity outside the pituitary, though the clinical relevance of this observation is uncertain.
Ipamorelin is a synthetic pentapeptide that acts on the growth hormone secretagogue receptor, also known as the ghrelin receptor. Its sequence contains five amino acid residues, including a non-natural residue that increases stability against enzymatic breakdown. The compound was developed in the 1990s as part of research into small peptides that stimulate pituitary hormone release. Unlike larger protein hormones, it can be produced by solid-phase peptide synthesis and characterized by standard analytical methods.
At the receptor level, ipamorelin binds GHS-R1a and triggers signaling through Gq-coupled pathways. Activation leads to calcium release and downstream effects in pituitary somatotroph cells. These events promote the release of growth hormone into circulation. The response depends on the presence of the receptor and on the physiological state of the animal or tissue studied. Because the receptor is also found in other tissues, effects beyond the pituitary have been examined in laboratory models, though the extent of those effects remains an area of ongoing study.
Activity is mediated mainly through the growth hormone secretagogue receptor, now generally called the ghrelin receptor or GHS-R1a. Binding at this G-protein-coupled receptor triggers phospholipase C signaling, calcium mobilization, and release of growth hormone from pituitary somatotrophs. Reports describe less pronounced stimulation of adrenocorticotropic hormone and prolactin compared with earlier secretagogues such as hexarelin or GHRP-6. Selectivity figures vary between assay systems, so the degree of separation from other secretagogues is an area of ongoing comparison rather than a fixed constant.
In animal and early human studies, ipamorelin produces pulsatile growth hormone release and a secondary rise in insulin-like growth factor 1. The magnitude and duration of that rise depend on route, sampling schedule, and the baseline endocrine state of the subject. Whether repeated exposure alters the response over time is not firmly settled, since some reports describe stable pulsatility while others note attenuation. Most published data come from small samples, which limits the strength of any general claim about long-term behavior.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class of compounds. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, a structure that differs from natural ghrelin in length and in the presence of non-natural amino acid residues. Early laboratory work described it as a comparatively selective agent that stimulates growth hormone release with limited effect on other pituitary hormones. The compound is supplied as a lyophilized solid for research use and has no identified natural source in the body.
=== Photodynamic (PDT) mechanism === PDT can induce many cellular pathways, and its main purpose is to induce cell death, either by apoptosis or necrosis. The fundamental process of photodynamic reactions involves three elements: photosensitizers (PS), light of a specific wavelength, and oxygen present in the cell. The interaction of these three components produced a desirable effect inside targeted tissues. Apart from light and oxygen, photosensitizers are compounds designed to absorb light at particular wavelengths during therapy, which enables them to initiate therapeutic processes. Two pathway branches interact and contribute to different ratios during PDT therapy, affecting its efficiency. Both mechanisms have the same first stage. When cells absorb photosensitizers and are exposed to light that aligns with their absorption spectrum, these substances photo-excite from their stable ground state (S°) to an energised excited singlet state (S1). Some energy is emitted as fluorescence, remaining energy directs the photosensitizer molecule into triplet state T1. Type I pathway of photodynamic reaction: T1 state PS can then interact with nearby molecules. Energy transfers between the photosensitizer and other molecules in the form of hydrogen and electrons, resulting in the creation of free radicals and anion radicals. These radicals remain in ground state and react with oxygen, leading to the formation of reactive oxygen species (ROS) and superoxide anion radicals (O2•−), which further react with oxygen to generate ROS.
In the Southern Hemisphere, the Pole of Cold is currently located in Antarctica, at the Russian (formerly Soviet) Antarctic station Vostok at 78°28′S 106°48′E. On July 21, 1983, this station recorded a temperature of −89.2 °C (−128.6 °F). This is the lowest naturally occurring temperature ever recorded on Earth. Vostok station is located at the elevation of 3,488 m (11,444 ft) above sea level, far removed from the moderating influence of oceans (more than 1,000 km [620 mi] from the nearest sea coast), and high latitude that results in almost three months of civil polar night every year (early May to end of July), all combine to produce an environment where temperatures rarely rise above −25 °C (−13 °F) during summer and frequently fall below −70 °C (−94 °F) in winter. By comparison, the South Pole, due to its lower elevation, is, on average, 5 to 10 °C (9 to 18 °F) warmer than Vostok, and the lowest temperature ever recorded at the South Pole is −82.8 °C (−117 °F). It is generally thought that Vostok is not the coldest place in Antarctica, and there are locations (notably, Dome A) that are modestly colder on average. The now inactive Plateau Station, located on the central Antarctic plateau, recorded an average yearly temperature that was consistently lower than that of Vostok Station during the 37-month period that it was active in the late 1960s, with its average for the coldest month being several degrees lower than the same statistic for Vostok. Plateau Station never recorded a temperature that surpassed the record low set at Vostok.
== In degradation of drug delivery systems == Among various types of cancer, lung cancer, larynx cancer, mouth cancer, and breast cancer exhibit higher concentrations (10-40 mM) of GSH compared to healthy cells. Thus, drug delivery systems containing disulfide bonds, typically cross-linked micro-nanogels, stand out for their ability to degrade in the presence of high concentrations of glutathione (GSH). This degradation process releases the drug payload specifically into cancerous or tumorous tissue, leveraging the significant difference in redox potential between the oxidizing extracellular environment and the reducing intracellular cytosol. When internalized by endocytosis, nanogels encounter high concentrations of GSH inside the cancer cell. GSH, a potent reducing agent, donates electrons to disulfide bonds in the nanogels, initiating a thiol-disulfide exchange reaction. This reaction breaks the disulfide bonds, converting them into two thiol groups, and facilitates targeted drug release where it is needed most. This reaction is called a thiol-disulfide exchange reaction.
== History == In 1799, British chemist Charles Hatchett experimented with decalcifying the shells of various crustaceans, finding that a soft, yellow and cartilage-like substance was left behind that is now known to be chitin. In 1859, French physiologist Charles Marie Benjamin Rouget found that boiling chitin in potassium hydroxide solution could deacetylate it to produce a substance that was soluble in dilute organic acids, that he called chitine modifiée. In 1894, German chemist Felix Hoppe-Seyler named the substance chitosan. From 1894 to 1930 there was a period of debate and confusion over the exact composition of chitin and particularly whether animal and fungal forms were the same chemicals. In 1930 the first chitosan films and fibres were patented but competition from petroleum-derived polymers limited their uptake. It was not until the 1970s that there was renewed interest in the compound, spurred partly by laws that prevented the dumping of untreated shellfish waste.
=== Signaling pathways === Ribose is a building block in secondary signaling molecules such as cyclic adenosine monophosphate (cAMP) which is derived from ATP. One specific case in which cAMP is used is in cAMP-dependent signaling pathways. In cAMP signaling pathways, either a stimulative or inhibitory hormone receptor is activated by a signal molecule. These receptors are linked to a stimulative or inhibitory regulative G-protein. When a stimulative G-protein is activated, adenylyl cyclase catalyzes ATP into cAMP by using Mg2+ or Mn2+. cAMP, a secondary messenger, then goes on to activate protein kinase A, which is an enzyme that regulates cell metabolism. Protein kinase A regulates metabolic enzymes by phosphorylation which causes a change in the cell depending on the original signal molecule. The opposite occurs when an inhibitory G-protein is activated; the G-protein inhibits adenylyl cyclase and ATP is not converted to cAMP.
Sources: en.wikipedia.org
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
This system is used in many unrelated animals: ants, bees, and wasps, termites, naked mole-rat, Damaraland mole-rat, Synalpheus regalis shrimp, certain beetles, some gall thrips and some aphids. Oxygenate blood came about in unrelated animals groups: vertebrates use iron (hemoglobin) and crustaceans and many mollusks use copper (hemocyanin). Biomineralization the secrete protective shells or carapaces made out of organically made hard materials like mineral carbonates and organic chitins came about in unrelated species all at the same time during the cambrian Explosion in: mollusks, brachiopods, arthropods, bryozoans, echinoderms, tube worms. Reef builders, a number of unrelated species of sea life build rocky like reefs: some types of bacteria make stromatolites, various sponges build skeletons of calcium carbonate, like: archaeocyath sponges, and stromatoporoid sponges, corals, some anthozoan cnidarians, bryozoans, calcareous algae and some bivalves (rudist bivalves). Magnetite for orientation, magnetically charged particles of magnetite for directional sensing have been found in unrelated species of salmon, rainbow trout, some butterflies and birds. Hydrothermal vent adaptations like the use of bacteria housed in body flesh or in special organs, to the point they no longer have mouth parts, have been found in unrelated hydrothermal vent species of mollusks and tube worms (like the giant tube worm). Lichens are partnerships of fungi and algae. Each "species" of lichen is make of different fungi and algae species, thus each has to come about independently.
=== Critical response === That Awkward Moment received mostly negative reviews from critics. Rotten Tomatoes gives the film an approval rating of 23% based on reviews from 142 critics, with an average rating of 4.10 out of 10. The site's consensus is: "Formulaic and unfunny, That Awkward Moment wastes a charming cast on a contrived comedy that falls short of the date movies it seems to be trying to subvert." On Metacritic, the film has a weighted average score of 36 out of 100, based on reviews from 33 critics, indicating "generally unfavorable reviews". Scott Foundas of Variety wrote: "The pic falls well short of its efforts to combine the raucous vulgarity of the "Hangover" movies with Cameron Crowe-ish depth of feeling." Peter Travers of Rolling Stone complained that the film was full of clichés but that "The compensation comes in the three lead actors, all way too good for the material dished out by writer-director Tom Gormican." Stephen Holden of The New York Times called it "A vile, witless sex comedy."
Cardiac output (CO) is a measurement of the amount of blood pumped by each ventricle (stroke volume) in one minute. This is calculated by multiplying the stroke volume (SV) by the beats per minute of the heart rate (HR). So that: CO = SV x HR. The cardiac output is normalized to body size through body surface area and is called the cardiac index. The average cardiac output, using an average stroke volume of about 70mL, is 5.25 L/min, with a normal range of 4.0–8.0 L/min. The stroke volume is normally measured using an echocardiogram and can be influenced by the size of the heart, physical and mental condition of the individual, sex, contractility, duration of contraction, preload and afterload. Preload refers to the filling pressure of the atria at the end of diastole, when the ventricles are at their fullest. A main factor is how long it takes the ventricles to fill: if the ventricles contract more frequently, then there is less time to fill and the preload will be less. Preload can also be affected by a person's blood volume. The force of each contraction of the heart muscle is proportional to the preload, described as the Frank-Starling mechanism. This states that the force of contraction is directly proportional to the initial length of muscle fiber, meaning a ventricle will contract more forcefully, the more it is stretched. Afterload, or how much pressure the heart must generate to eject blood at systole, is influenced by vascular resistance. It can be influenced by narrowing of the heart valves (stenosis) or contraction or relaxation of the peripheral blood vessels.
=== Alcoholism === Research in animal models and clinical studies in alcoholic patients have found that tiapride has anxiolytic effects. Dopamine hyperactivity has been linked with alcohol withdrawal syndrome (AWS), suggesting that tiapride's antidopaminergic effects are the most likely mechanism for its clinical efficacy, although others believe some other mechanism might be involved. Alcoholic patients treated with tiapride at a dosage of 300 mg/day reported reduced psychological distress and improved abstinence from alcohol. In another study in which alcoholic patients were given titrated doses up to 800 mg/day, subjects showed significant improvements in ratings of withdrawal, craving, psychiatric symptoms and quality of life. While tiapride does not affect positive symptoms of psychosis such as hallucinosis or delirium sometimes manifested in alcohol withdrawal syndrome, if combined with a drug such as carbamazepine that addresses those symptoms, it is ideal for treating alcohol dependency because its metabolism does not depend on liver function and it has low potential for abuse. This sets it apart from the benzodiazepines, which are contraindicated with alcohol and can be addictive. Moreover, tiapride's rapid onset makes intravenous or intramuscular injection prior to or during withdrawal episodes particularly effective.
Sources: en.wikipedia.org
It has not been approved as a therapeutic by major regulators, and the human trial record is small and dated. Material available today is mostly sold as a research chemical for laboratory use. Approval and restriction status varies by country.
It binds the ghrelin receptor, known as the growth hormone secretagogue receptor type 1a. Activation of that receptor triggers signaling that leads to growth hormone release. Selectivity for growth hormone over cortisol and prolactin is the property most often cited for this compound.
Published estimates place the circulating half-life at roughly two hours in humans. Clearance involves peptidase activity and renal handling. Because the peptide is short-lived, release patterns after administration are usually described as pulsatile rather than sustained.
Ipamorelin is a synthetic pentapeptide that stimulates growth hormone release by activating the ghrelin receptor. It is handled as a research tool rather than as a licensed therapeutic product. Its short chain length makes it comparatively simple to synthesize and analyze.